PLEKHO1 Rabbit Polyclonal Antibody

CAT#: TA342531

Rabbit Polyclonal Anti-PLEKHO1 Antibody

Product Images

WB Suggested Anti-PLEKHO1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLEKHO1 antibody: synthetic peptide directed towards the N terminal of human PLEKHO1. Synthetic peptide located within the following region: MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: pleckstrin homology domain containing O1
• Database Link:
  NP_057358
  Entrez Gene 51177 Human
  UniProt ID Q53GL0
• Background: PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.
• Synonyms: CKIP-1; CKIP1; JBP; OC120
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Bovine: 86%; Rat: 82%