NETO2 Rabbit Polyclonal Antibody

CAT#: TA342354

Rabbit Polyclonal Anti-NETO2 Antibody

Product Images

WB Suggested Anti-NETO2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysate.NETO2 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NETO2 antibody: synthetic peptide directed towards the N terminal of human NETO2. Synthetic peptide located within the following region: GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: neuropilin and tolloid like 2
• Database Link:
  NP_060562
  Entrez Gene 81831 Human
  UniProt ID Q8NC67
• Background: This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in rats encodes a protein that modulates glutamate signaling in the brain by regulating kainate receptor function. Expression of this gene may be a biomarker for proliferating infantile hemangiomas. A pseudogene of this gene is located on the long arm of chromosome 8. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
• Synonyms: BTCL2; NEOT2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane