Cited4 Rabbit Polyclonal Antibody

CAT#: TA342331

Rabbit Polyclonal Anti-Cited4 Antibody

Product Images

WB Suggested Anti-Cited4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Cited4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4
• Database Link:
  NP_062509
  Entrez Gene 56222 Mouse
  UniProt ID Q9WUL8
• Background: Cited4 acts as transcriptional coactivator for TFAP2/AP-2.Cited4 may function as an inhibitor of transactivation by HIF1A by disrupting HIF1A interaction with CREBBP.Cited4 may be involved in regulation of gene expression during development and differentiation of blood cells, endothelial cells and mammary epithelial cells.
• Synonyms: MRG-2; MRG2
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 85%