SUN2 Rabbit Polyclonal Antibody

CAT#: TA341973

Rabbit Polyclonal Anti-UNC84B Antibody

Product Images

WB Suggested Anti-UNC84B Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate.SUN2 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UNC84B antibody: synthetic peptide directed towards the C terminal of human UNC84B. Synthetic peptide located within the following region: CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: Sad1 and UNC84 domain containing 2
• Database Link:
  NP_001186508
  Entrez Gene 25777 Human
  UniProt ID Q9UH99
• Background: SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' acrossThe nuclear envelope, known asThe LINC complex, via interaction withThe conserved luminal KASH domain of nesprins (e.g., SYNE1; MIM 608441) located inThe outer nuclear membrane (ONM).The LINC complex provides a direct connection betweenThe nuclear lamina andThe cytoskeleton, which contributes to nuclear positioning and cellular rigidity (summary by Haque et al., 2010 [PubMed 19933576]). [supplied by OMIM, Nov 2010]. Transcript Variant:This variant (1) representsThe longest transcript and encodesThe longer isoform (a). Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC094797.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087, ERS025093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
• Synonyms: UNC84B
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%

Reference Data

• Protein Families: Transmembrane