LRRC8B Rabbit Polyclonal Antibody

CAT#: TA341971

Rabbit Polyclonal Anti-LRRC8B Antibody

Product Images

WB Suggested Anti-LRRC8B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LRRC8B antibody: synthetic peptide directed towards the N terminal of human LRRC8B. Synthetic peptide located within the following region: PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: leucine-rich repeat containing 8 family member B
• Database Link:
  NP_056165
  Entrez Gene 23507 Human
  UniProt ID Q6P9F7
• Background: Component ofThe volume-regulated anion channel (VRAC, also named VSOAC channel), an anion channel required to maintain a constant cell volume in response to extracellular or intracellular osmotic changes.The VRAC channel conducts iodide better than chloride and may also conduct organic osmolytes like taurine. It is unclear whether LRRC8B constitutes a pore-forming subunit or whether it is closely associated withThe pore.
• Synonyms: TA-LRRP; TALRRP
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%

Reference Data

• Protein Families: Transmembrane