POMT2 Rabbit Polyclonal Antibody

CAT#: TA341918

Rabbit Polyclonal Anti-POMT2 Antibody

Product Images

WB Suggested Anti-POMT2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POMT2 antibody: synthetic peptide directed towards the middle region of human POMT2. Synthetic peptide located within the following region: AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: protein O-mannosyltransferase 2
• Database Link:
  NP_037514
  Entrez Gene 29954 Human
  UniProt ID Q9UKY4
• Background: The protein encoded byThis gene is an O-mannosyltransferase that requires interaction withThe product ofThe POMT1 gene for enzymatic function.The encoded protein is found inThe membrane ofThe endoplasmic reticulum. Defects inThis gene are a cause of Walker-Warburg syndrome (WWS). [provided by RefSeq, Oct 2008]
• Synonyms: LGMD2N; MDDGA2; MDDGB2; MDDGC2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: O-Mannosyl glycan biosynthesis