GJE1 (GJC3) Rabbit Polyclonal Antibody

CAT#: TA341681

Rabbit Polyclonal Anti-GJC3 Antibody

Product Images

WB Suggested Anti-GJC3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GJC3 antibody: synthetic peptide directed towards the middle region of human GJC3. Synthetic peptide located within the following region: WHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: gap junction protein gamma 3
• Database Link:
  NP_853516
  Entrez Gene 349149 Human
  UniProt ID Q8NFK1
• Background: This gene encodes a gap junction protein.The encoded protein, also known as a connexin, plays a role in formation of gap junctions, which provide direct connections between neighboring cells. Mutations inThis gene have been reported to be associated with nonsyndromic hearing loss. [provided by RefSeq, Feb 2010]
• Synonyms: CX29; CX30.2; CX31.3; GJE1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane