HELB Rabbit Polyclonal Antibody

CAT#: TA341626

Rabbit Polyclonal Anti-HELB Antibody

Product Images

WB Suggested Anti-HELB Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HELB antibody: synthetic peptide directed towards the N terminal of human HELB. Synthetic peptide located within the following region: FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 120 kDa
• Gene Name: helicase (DNA) B
• Database Link:
  NP_387467
  Entrez Gene 92797 Human
  UniProt ID Q8NG08
• Background: This gene encodes a DNA-dependent ATPase which catalyzesThe unwinding of DNA necessary for DNA replication, repair, recombination, and transcription.This gene is thought to function specifically duringThe S phase entry ofThe cell cycle. [provided by RefSeq, Mar 2012]
• Synonyms: DHB; hDHB
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 79%