Helicase SKI2W (SKIV2L) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of superkiller viralicidic activity 2-like (S. cerevisiae) (SKIV2L)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Helicase SKI2W"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SKIV2L antibody: synthetic peptide directed towards the middle region of human SKIV2L. Synthetic peptide located within the following region: SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 138 kDa |
Gene Name | Ski2 like RNA helicase |
Database Link | |
Background | DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein, which is a human homologue of yeast SKI2 and may be involved in antiviral activity by blocking translation of poly(A) deficient mRNAs.This gene is located inThe class III region ofThe major histocompatibility complex. [provided by RefSeq, Jul 2008] |
Synonyms | 170A; DDX13; HLP; SKI2; SKI2W; SKIV2; SKIV2L1; THES2 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 79% |
Reference Data | |
Protein Pathways | RNA degradation |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.