DDX39 (DDX39A) Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DDX39 antibody: synthetic peptide directed towards the N terminal of human DDX39. Synthetic peptide located within the following region: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 47 kDa |
Gene Name | DEAD-box helicase 39A |
Database Link | |
Background | This gene encodes a member ofThe DEAD box protein family.These proteins are characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThe DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene is thought to play a role inThe prognosis of patients with gastrointestinal stromal tumors. A pseudogene ofThis gene is present on chromosome 13. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants ofThis gene have been described, butTheir full-length nature is not known. [provided by RefSeq, Sep 2013] |
Synonyms | BAT1; BAT1L; DDX39; DDXL; URH49 |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rat: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%; Bovine: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review