AKAP5 Rabbit Polyclonal Antibody

CAT#: TA341549

Rabbit Polyclonal Anti-AKAP5 Antibody

Product Images

WB Suggested Anti-AKAP5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AKAP5 antibody: synthetic peptide directed towards the middle region of human AKAP5. Synthetic peptide located within the following region: KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: A-kinase anchoring protein 5
• Database Link:
  NP_004848
  Entrez Gene 9495 Human
  UniProt ID P24588
• Background: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which haveThe common function of binding toThe regulatory subunit of protein kinase A (PKA) and confiningThe holoenzyme to discrete locations withinThe cell.This gene encodes a member ofThe AKAP family.The encoded protein binds toThe RII-beta regulatory subunit of PKA, and also to protein kinase C andThe phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchorThe PKA protein at postsynaptic densities (PSD) and be involved inThe regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. [provided by RefSeq, Jul 2008]
• Synonyms: AKAP75; AKAP79; H21
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Yeast: 82%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome