Nup53 (NUP35) Rabbit Polyclonal Antibody

CAT#: TA340280

Rabbit Polyclonal Anti-NUP35 Antibody

Product Images

WB Suggested Anti-NUP35 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUP35 antibody: synthetic peptide directed towards the C terminal of human NUP35. Synthetic peptide located within the following region: STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: nucleoporin 35kDa
• Database Link:
  NP_612142
  Entrez Gene 129401 Human
  UniProt ID Q8NFH5
• Background: NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC.
• Synonyms: MP-44; MP44; NP44; NUP53
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%