CC2D1B Rabbit Polyclonal Antibody

CAT#: TA340210

Rabbit Polyclonal Anti-CC2D1B Antibody

Product Images

WB Suggested Anti-CC2D1B Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CC2D1B antibody: synthetic peptide directed towards the C terminal of human CC2D1B. Synthetic peptide located within the following region: IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: coiled-coil and C2 domain containing 1B
• Database Link:
  NP_115825
  Entrez Gene 200014 Human
  UniProt ID Q5T0F9
• Background: CC2D1B belongs to the CC2D1 family. It contains 1 C2 domain. A function of Cc2d1b/Cc2d1a and their Drosophila homologue l(2)gd in D.melanogaster in Notch trafficking have been reported.
• Synonyms: RP11-155O18.2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%