Carboxylesterase 7 (CES5A) Rabbit Polyclonal Antibody

CAT#: TA339870

Rabbit Polyclonal Anti-CES5A Antibody

Product Images

WB Suggested Anti-CES5A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CES7 antibody: synthetic peptide directed towards the N terminal of human CES7. Synthetic peptide located within the following region: SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: carboxylesterase 5A
• Database Link:
  NP_659461
  Entrez Gene 221223 Human
  UniProt ID Q6NT32
• Background: CES7 Belongs to the type-B carboxylesterase/lipase family and involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.
• Synonyms: CAUXIN; CES4C1; CES5; CES7; HEL126
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Drug metabolism - other enzymes