ZNF418 Rabbit Polyclonal Antibody

CAT#: TA339788

Rabbit Polyclonal Anti-ZNF418 Antibody

Product Images

WB Suggested Anti-ZNF418 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF418 antibody: synthetic peptide directed towards the N terminal of human ZNF418. Synthetic peptide located within the following region: HRCEAWGNKLYDSSNRPHQNQYLGEKPYRSSVEEALFVKRCKFHVSEESS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: zinc finger protein 418
• Database Link:
  NP_597717
  Entrez Gene 147686 Human
  UniProt ID Q8TF45
• Background: ZNF418 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF418 is a transcriptional repressor.
• Synonyms: FLJ31551; KIAA1956; MGC138449
• Note: Immunogen Sequence Homology: Human: 100%