BCAT1 Rabbit Polyclonal Antibody

CAT#: TA339285

Rabbit Polyclonal Anti-BCAT1 Antibody

Product Images

WB Suggested Anti-BCAT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BCAT1 antibody: synthetic peptide directed towards the N terminal of human BCAT1. Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: branched chain amino acid transaminase 1
• Database Link:
  NP_005495
  Entrez Gene 586 Human
  UniProt ID P54687
• Background: This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clinical disorders have been attributed to a defect of branched-chain amino acid transamination: hypervalinemia and hyperleucine-isoleucinemia. As there is also a gene encoding a mitochondrial form of this enzyme, mutations in either gene may contribute to these disorders. Alternatively spliced transcript variants have been described. [provided by RefSeq, May 2010]
• Synonyms: BCATC; BCT1; ECA39; MECA39; PNAS121; PP18
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Horse: 92%; Sheep: 92%; Pig: 85%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Pantothenate and CoA biosynthesis, Valine, leucine and isoleucine biosynthesis, Valine, leucine and isoleucine degradation