KLHDC5 (KLHL42) Rabbit Polyclonal Antibody

CAT#: TA339241

Rabbit Polyclonal Anti-KLHL42

Product Images

WB Suggested Anti-KLHL42 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLHDC5 antibody: synthetic peptide directed towards the N terminal of human KLHDC5. Synthetic peptide located within the following region: LQEACLRFMVVHFHEVLCKPQFHLLGSPPQAPGDVSLKQRLREARMTGTP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: kelch like family member 42
• Database Link:
  NP_065833
  Entrez Gene 57542 Human
  UniProt ID Q9P2K6
• Background: KLHL42 contains 1 BTB (POZ) domain and 6 Kelch repeats. It is phosphorylated upon DNA damage, probably by ATM or ATR. The exact functions of KLHL42 remain unknown.
• Synonyms: Ctb9; KLHDC5
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 85%