DCAF12 Rabbit Polyclonal Antibody

CAT#: TA339195

Rabbit Polyclonal Anti-DCAF12

Product Images

WB Suggested Anti-DCAF12 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDR40A antibody: synthetic peptide directed towards the N terminal of human WDR40A. Synthetic peptide located within the following region: ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: DDB1 and CUL4 associated factor 12
• Database Link:
  NP_056212
  Entrez Gene 25853 Human
  UniProt ID Q5T6F0
• Background: The function of DCAF12 has not yet been determined.This gene was identified by isolating cDNA from a size-fractionated library derived from brain in an attempt to characterize genes encoding large proteins. The function of the protein encoded by this gene has not yet been determined.
• Synonyms: CT102; KIAA1892; TCC52; WDR40A
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 92%; Horse: 86%; Mouse: 86%