HEMK2 (N6AMT1) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of N-6 adenine-specific DNA methyltransferase 1 (putative) (N6AMT1), transcript variant 2
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "HEMK2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-N6AMT1 antibody: synthetic peptide directed towards the N terminal of human N6AMT1. Synthetic peptide located within the following region: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 20 kDa |
Gene Name | N-6 adenine-specific DNA methyltransferase 1 (putative) |
Database Link | |
Background | This gene encodes an N(6)-adenine-specific DNA methyltransferase. The encoded enzyme may be involved in the methylation of release factor I during translation termination. This enzyme is also involved in converting the arsenic metabolite monomethylarsonous acid to the less toxic dimethylarsonic acid. Alternative splicing pf this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 11. [provided by RefSeq, Jul 2014] |
Synonyms | C21orf127; HEMK2; m.HsaHemK2P; MTQ2; N6AMT; PRED28 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Bovine: 93%; Pig: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.