IL22 RA2 (IL22RA2) Rabbit Polyclonal Antibody
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Transient overexpression lysate of interleukin 22 receptor, alpha 2 (IL22RA2), transcript variant 2
USD 436.00
Other products for "IL22 RA2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-IL22RA2 antibody is: synthetic peptide directed towards the C-terminal region of Human IL22RA2. Synthetic peptide located within the following region: NITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 26 kDa |
Gene Name | interleukin 22 receptor subunit alpha 2 |
Database Link | |
Background | The protein encoded by this gene is a soluble class II cytokine receptor. This protein has been shown to specifically bind to interleukin 22 (IL22), block the interaction of IL22 with its cell surface receptor, and thus inhibit IL22 activity. This protein functions as an IL22 antagonist, and may be important in the regulation of inflammatory response. Three alternatively spliced transcript variants encoding distinct isoforms have been described. |
Synonyms | CRF2-10; CRF2-S1; CRF2X; IL-22BP; IL-22R-alpha-2; IL-22RA2; ZCYTOR16 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 86% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.