HGSNAT Rabbit Polyclonal Antibody

CAT#: TA337878

Rabbit Polyclonal Anti-HGSNAT Antibody

Product Images

WB Suggested Anti-HGSNAT Antibody; Titration: 1.0 ug/ml; Positive Control: OVCAR-3 Whole Cell HGSNAT is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HGSNAT antibody is: synthetic peptide directed towards the C-terminal region of Human HGSNAT. Synthetic peptide located within the following region: VKGLWTGTPFFYPGMNSILVYVGHEVFENYFPFQWKLKDNQSHKEHLTQN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 2 kDa
• Gene Name: heparan-alpha-glucosaminide N-acetyltransferase
• Database Link:
  NP_689632
  Entrez Gene 138050 Human
  UniProt ID Q68CP4
• Background: This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate.
• Synonyms: HGNAT; MPS3C; TMEM76
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Horse: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosaminoglycan degradation, Lysosome, Metabolic pathways