SLC38A9 Rabbit Polyclonal Antibody

CAT#: TA337782

Rabbit Polyclonal Anti-SLC38A9 Antibody

Product Images

WB Suggested Anti-SLC38A9 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC38A9 antibody: synthetic peptide directed towards the middle region of human SLC38A9. Synthetic peptide located within the following region: VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: solute carrier family 38 member 9
• Database Link:
  NP_775785
  Entrez Gene 153129 Human
  UniProt ID Q8NBW4
• Background: The exact function of SLC38A9 remains unknown.
• Synonyms: URLC11
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Rabbit: 86%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane