OR2S2 Rabbit Polyclonal Antibody

CAT#: TA337495

Rabbit Polyclonal Anti-OR2S2 Antibody

Product Images

Host: Rabbit; Target Name: OR2S2; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-OR2S2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2S2. Synthetic peptide located within the following region: KKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: olfactory receptor family 2 subfamily S member 2 (gene/pseudogene)
• Database Link:
  NP_063950
  Entrez Gene 56656 Human
  UniProt ID Q9NQN1
• Background: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
• Synonyms: OR37A; OST715
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 86%; Horse: 86%; Rat: 85%; Guinea pig: 85%; Dog: 79%; Mouse: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Olfactory transduction