HENMT1 Rabbit Polyclonal Antibody

CAT#: TA337342

Rabbit Polyclonal Anti-HENMT1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of chromosome 1 open reading frame 59 (C1orf59), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human chromosome 1 open reading frame 59 (C1orf59), transcript variant 1, 20 µg
    • 20 ug

USD 867.00

Other products for "HENMT1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-HENMT1 antibody is: synthetic peptide directed towards the C-terminal region of Human HENMT1. Synthetic peptide located within the following region: QVESLRVSHLPRRKEQAGERGDKPKDIGGSKAPVPCFGPVFTEVEKAKIE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44 kDa
Gene Name HEN1 methyltransferase homolog 1
Background HENMT1 is a methyltransferase that adds a 2'-O-methyl group at the 3'-end of piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. This probably protects the 3'-end of piRNAs from uridylation activity and subsequent degradation. Stabilization of piRNAs is essential for gametogenesis.
Synonyms C1orf59; HEN1
Note Immunogen Sequence Homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.