Glycoprotein 2 (GP2) Rabbit Polyclonal Antibody

CAT#: TA336152

Rabbit Polyclonal Anti-GP2 Antibody

Product Images

WB Suggested Anti-GP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human heart

• 

  3Hum. Fetal Muscle; Host: Rabbit; Target Name: GP2; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  4Human HepG2; Host: Rabbit; Target Name: GP2; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml.There is BioGPS gene expression data showing that GP2 is expressed in HepG2

• 

  Anti-GP2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GP2 Antibody: synthetic peptide directed towards the middle region of human GP2. Synthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: glycoprotein 2
• Database Link:
  NP_001007242
  Entrez Gene 2813 Human
  UniProt ID P55259
• Background: GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
• Synonyms: ZAP75
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Pig: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane