SRD5A2L2 (TECRL) Rabbit Polyclonal Antibody

CAT#: TA336128

Rabbit Polyclonal Anti-Tecrl Antibody

Product Images

Host: Rabbit; Target Name: Tecrl; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Tecrl Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tecrl. Synthetic peptide located within the following region: AGPLKTTTAVKHSKTTHFEIEILDAHTRKQICIVDKVTQTSTIHDVKQKF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: trans-2,3-enoyl-CoA reductase-like
• Database Link:
  NP_001010874
  Entrez Gene 243078 Mouse
  UniProt ID Q5HYJ1
• Background: The function of this protein remains unknown.
• Synonyms: GPSN2L; SRD5A2L2; TERL
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Bovine: 92%; Horse: 85%; Rabbit: 85%; Pig: 83%; Guinea pig: 83%

Reference Data

• Protein Families: Transmembrane