PTRH2 Rabbit Polyclonal Antibody

CAT#: TA336083

Rabbit Polyclonal Anti-PTRH2 Antibody

Product Images

WB Suggested Anti-PTRH2 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PTRH2 Antibody: synthetic peptide directed towards the C terminal of human PTRH2. Synthetic peptide located within the following region: RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: peptidyl-tRNA hydrolase 2
• Database Link:
  NP_001015509
  Entrez Gene 51651 Human
  UniProt ID Q9Y3E5
• Background: The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.
• Synonyms: BIT1; CFAP37; CGI-147; IMNEPD; PTH; PTH 2; PTH2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Transmembrane