SFRS7 (SRSF7) Rabbit Polyclonal Antibody

CAT#: TA336042

Rabbit Polyclonal Anti-SFRS7 Antibody

Product Images

WB Suggested Anti-SFRS7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the middle region of human SFRS7. Synthetic peptide located within the following region: SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: serine/arginine-rich splicing factor 7
• Database Link:
  NP_001026854
  Entrez Gene 6432 Human
  UniProt ID Q16629
• Background: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.
• Synonyms: 9G8; AAG3; SFRS7
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Pathways: Spliceosome