PRICKLE3 Rabbit Polyclonal Antibody

CAT#: TA335699

Rabbit Polyclonal Anti-PRICKLE3 Antibody

Product Images

WB Suggested Anti-PRICKLE3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRICKLE3 Antibody: synthetic peptide directed towards the C terminal of human PRICKLE3. Synthetic peptide located within the following region: GAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQSTPRVSFRDPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: prickle planar cell polarity protein 3
• Database Link:
  NP_006141
  Entrez Gene 4007 Human
  UniProt ID O43900
• Background: LIM domain only 6 is a three LIM domain-containing protein. The LIM domain is a cysteine-rich sequence motif that binds zinc atoms to form a specific protein-binding interface for protein-protein interactions.LIM domain only 6 is a three LIM domain-containing protein. The LIM domain is a cysteine-rich sequence motif that binds zinc atoms to form a specific protein-binding interface for protein-protein interactions.
• Synonyms: LMO6
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 91%; Rat: 86%; Mouse: 86%; Dog: 83%; Horse: 83%; Guinea pig: 79%