TTYH1 Rabbit Polyclonal Antibody

CAT#: TA335497

Rabbit Polyclonal Anti-TTYH1 Antibody

Product Images

WB Suggested Anti-TTYH1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TTYH1 Antibody: synthetic peptide directed towards the N terminal of human TTYH1. Synthetic peptide located within the following region: GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: tweety family member 1
• Database Link:
  NP_065710
  Entrez Gene 57348 Human
  UniProt ID Q9H313
• Background: TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.
• Synonyms: 4930459B04Rik; 6330408P11Rik; OTTMUSP00000024583; tty; tweety 1; tweety homolog 1 (Drosophila)
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Ion Channels: Other, Transmembrane