NUP155 Rabbit Polyclonal Antibody

CAT#: TA335374

Rabbit Polyclonal Anti-NUP155 Antibody

Product Images

WB Suggested Anti-NUP155 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NUP155 Antibody: synthetic peptide directed towards the N terminal of human NUP155. Synthetic peptide located within the following region: MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 153 kDa
• Gene Name: nucleoporin 155kDa
• Database Link:
  NP_705618
  Entrez Gene 9631 Human
  UniProt ID O75694
• Background: Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. The protein encoded by this gene does not contain the typical FG repeat sequences found in most vertebrate nucleoporins. Two protein isoforms are encoded by transcript variants of this gene.
• Synonyms: ATFB15; N155
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Zebrafish: 79%