CCDC107 Rabbit Polyclonal Antibody

CAT#: TA334807

Rabbit Polyclonal Anti-CCDC107 Antibody

Product Images

Host: Rabbit; Target Name: CCDC107; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCDC107 antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC107. Synthetic peptide located within the following region: PPLKDQRERTRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: coiled-coil domain containing 107
• Database Link:
  NP_777583
  Entrez Gene 203260 Human
  UniProt ID Q8WV48
• Background: This gene encodes a membrane protein which contains a coiled-coil domain in the central region. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: PSEC0222
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Mouse: 86%; Dog: 85%; Horse: 85%

Reference Data

• Protein Families: Transmembrane