SLC35C1 Rabbit Polyclonal Antibody

CAT#: TA333752

Rabbit Polyclonal Anti-SLC35C1 Antibody

Product Images

WB Suggested Anti-SLC35C1 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC35C1 Antibody: synthetic peptide directed towards the N terminal of human SLC35C1. Synthetic peptide located within the following region: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: solute carrier family 35 member C1
• Database Link:
  NP_060859
  Entrez Gene 55343 Human
  UniProt ID Q96A29
• Background: SLC35C1 is involved in GDP-fucose import from the cytoplasm into the Golgi lumen.
• Synonyms: CDG2C; FUCT1
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane