ACTR8 Rabbit Polyclonal Antibody

CAT#: TA333696

Rabbit Polyclonal Anti-ACTR8 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Purified recombinant protein of Human ARP8 actin-related protein 8 homolog (yeast) (ACTR8), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
    • 20 ug

USD 867.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "ACTR8"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ACTR8 Antibody is: synthetic peptide directed towards the N-terminal region of Human ACTR8. Synthetic peptide located within the following region: MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 70 kDa
Gene Name ARP8 actin-related protein 8 homolog
Background ACTR8 plays an important role in the functional organization of mitotic chromosomes.
Synonyms ARP8; hArp8; INO80N
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.