L3HYPDH Rabbit Polyclonal Antibody

CAT#: TA333517

Rabbit Polyclonal Anti-L3HYPDH Antibody

Product Images

Host: Rabbit; Target Name: L3HYPDH; Sample Tissue: OVCAR-3 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-L3HYPDH Antibody is: synthetic peptide directed towards the C-terminal region of Human L3HYPDH. Synthetic peptide located within the following region: AFKSSATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: trans-L-3-hydroxyproline dehydratase
• Database Link:
  NP_653182
  Entrez Gene 112849 Human
  UniProt ID Q96EM0
• Background: L3HYPDH catalyzes the dehydration of trans-3-hydroxy-L-proline to delta-1-pyrroline-2-carboxylate (Pyr2C). It may be required to degrade trans-3-hydroxy-L-proline from the diet and originating from the degradation of proteins such as collagen-IV that contain it.
• Synonyms: C14orf149
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 86%