LYSMD3 Rabbit Polyclonal Antibody

CAT#: TA333375

Rabbit Polyclonal Anti-LYSMD3 Antibody

Product Images

Host: Rabbit; Target Name: LYSMD3; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LYSMD3 Antibody is: synthetic peptide directed towards the C-terminal region of Human LYSMD3. Synthetic peptide located within the following region: SHLHSKITPPSQQREMENGIVPTKGIHFSQQDDHKLYSQDSQSPAAQQET
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: LysM domain containing 3
• Database Link:
  NP_938014
  Entrez Gene 116068 Human
  UniProt ID Q7Z3D4
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp686F0735; FLJ13542
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%

Reference Data

• Protein Families: Transmembrane