PPIAL4G Rabbit Polyclonal Antibody

CAT#: TA332191

Rabbit Polyclonal Anti-PPIAL4G Antibody

Product Images

Host: Rabbit; Target Name: PPIAL4G; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PPIAL4G Antibody is: synthetic peptide directed towards the C-terminal region of Human PPIAL4G. Synthetic peptide located within the following region: NGSQFFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKIT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: peptidylprolyl isomerase A like 4G
• Database Link:
  NP_001116540
  Entrez Gene 644591 Human
  UniProt ID P0DN37
• Background: PPIAL4G is a PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
• Synonyms: COAS-2
• Note: Immunogen sequence homology: Human: 100%; Rat: 86%; Dog: 85%; Pig: 85%; Goat: 85%; Horse: 85%; Mouse: 85%; Sheep: 85%; Bovine: 85%; Guinea pig: 85%