TICAM2 (TMED7-TICAM2) Rabbit Polyclonal Antibody

CAT#: TA332165

Rabbit Polyclonal Anti-TMED7-TICAM2 Antibody

Product Images

Host: Rabbit; Target Name: TIRAP3; Sample Tissue: RPMI-8226 whole cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TIRAP3 Antibody is: synthetic peptide directed towards the middle region of Human TIRAP3. Synthetic peptide located within the following region: FRLREAQGRSRAEDLNTRVAYWHSVDTSPGYHESDSKKSEDLSLCNVAEH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: TMED7-TICAM2 readthrough
• Database Link:
  NP_001157940
  Entrez Gene 100302736 Human
  UniProt ID Q86XR7
• Background: This locus represents naturally occurring read-through transcription between the neighboring transmembrane emp24 protein transport domain containing 7 (TMED7) and toll-like receptor adaptor molecule 2 (TICAM2) genes. Alternative splicing results in multiple transcript variants, one of which encodes a fusion protein that shares sequence identity with the products of each individual gene. This fusion product functions to negatively regulate the adaptor MyD88-independent toll-like receptor 4 pathway.
• Synonyms: TAG
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%