Germany
Japan
United Kingdom
China
ZNF276 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Transient overexpression lysate of zinc finger protein 276 (ZNF276), transcript variant a
USD 436.00
Other products for "ZNF276"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-ZNF276 Antibody: synthetic peptide directed towards the middle region of human ZNF276. Synthetic peptide located within the following region: SALAVKWPWDKETAPRLPQHRGWNPGDAPQTSQGRGTGTPVGAETKTLPS |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 60 kDa |
| Gene Name | zinc finger protein 276 |
| Database Link | |
| Background | The exact function of this protein remains unknown. |
| Synonyms | CENP-Z; CENPZ; ZADT; ZFP276; ZNF477 |
| Note | Immunogen sequence homology: Human: 100% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.