BPIL3 (BPIFB6) Rabbit Polyclonal Antibody

CAT#: TA331589

Rabbit Polyclonal Anti-BPIFB6 Antibody

Product Images

Host: Rabbit; Target Name: BPIFB6; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-BPIFB6 Antibody is: synthetic peptide directed towards the middle region of Human BPIFB6. Synthetic peptide located within the following region: QLDFSPVVQQQKGKTIKLADAGEALTFPEGYAKGSSQLLLPATFLSAELA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: BPI fold containing family B member 6
• Database Link:
  NP_777557
  Entrez Gene 128859 Human
  UniProt ID Q8NFQ5
• Background: The function of this protein remains unknown.
• Synonyms: BPIL3; LPLUNC6
• Note: Immunogen sequence homology: Human: 100%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein