GAS2L3 Rabbit Polyclonal Antibody

CAT#: TA331428

Rabbit polyclonal Anti-GAS2L3 Antibody

Product Images

Host: Rabbit; Target Name: GAS2L3; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GAS2L3 antibody is: synthetic peptide directed towards the N-terminal region of HUMAN GAS2L3. Synthetic peptide located within the following region: SISIPKSCCRHEELHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGDKIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: growth arrest specific 2 like 3
• Database Link:
  NP_777602
  Entrez Gene 283431 Human
  UniProt ID Q86XJ1
• Background: The function of this protein remains unknown.
• Synonyms: G2L3
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%