NSUN4 Rabbit Polyclonal Antibody

CAT#: TA331021

Rabbit polyclonal Anti-NSUN4 Antibody

Product Images

WB Suggested Anti-NSUN4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NSUN4 antibody: synthetic peptide directed towards the N terminal of human NSUN4. Synthetic peptide located within the following region: QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: NOP2/Sun RNA methyltransferase family member 4
• Database Link:
  NP_950245
  Entrez Gene 387338 Human
  UniProt ID Q96CB9
• Background: NSUN4 may have S-adenosyl-L-methionine-dependent methyl-transferase activity
• Synonyms: SHTAP
• Note: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 86%; Rabbit: 86%; Pig: 85%; Guinea pig: 85%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome