C14orf172 (TRMT61A) Rabbit Polyclonal Antibody

CAT#: TA330972

Rabbit polyclonal Anti-C14orf172 Antibody

Product Images

WB Suggested Anti-C14orf172 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: SH-SYSY cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C14orf172 antibody: synthetic peptide directed towards the N terminal of human C14orf172. Synthetic peptide located within the following region: MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: tRNA methyltransferase 61A
• Database Link:
  NP_689520
  Entrez Gene 115708 Human
  UniProt ID Q96FX7
• Background: The specific function of the protein remains unknown.
• Synonyms: C14orf172; GCD14; Gcd14p; hTRM61; TRM61
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome