TMPRSS11B Rabbit Polyclonal Antibody

CAT#: TA330793

Rabbit Polyclonal Anti-TMPRSS11B Antibody

Product Images

Host: Rabbit; Target Name: TMPRSS11B; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMPRSS11B antibody is: synthetic peptide directed towards the N-terminal region of Human TMPRSS11B. Synthetic peptide located within the following region: DNCENAASQASTNLSKDIETKMLNAFQNSSIYKEYVKSEVIKLLPNANGS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: transmembrane protease, serine 11B
• Database Link:
  NP_872308
  Entrez Gene 132724 Human
  UniProt ID Q86T26
• Background: TMPRSS11B is a probable serine protease.
• Synonyms: DKFZp686L1818
• Note: Human: 100%; Rabbit: 100%; Rat: 86%; Horse: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane