ZCWPW1 Rabbit Polyclonal Antibody

CAT#: TA330663

Rabbit Polyclonal Anti-ZCWPW1 Antibody

Product Images

Host: Rabbit; Target Name: ZCWPW1; Sample Tissue: OVCAR-3 Whole Cell lysates; Antibody Dilution: 1.0ug/ml; ZCWPW1 is supported by BioGPS gene expression data to be expressed in OVCAR-3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZCWPW1 antibody is: synthetic peptide directed towards the N-terminal region of Human ZCWPW1. Synthetic peptide located within the following region: KATMKNVPSREQEKKRKAQINKQAEKKEKEKSSLTNAEFEEIVQIVLQKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: zinc finger CW-type and PWWP domain containing 1
• Database Link:
  NP_060454
  Entrez Gene 55063 Human
  UniProt ID Q9H0M4
• Background: The function of this protein remains unknown.
• Synonyms: ZCW1
• Note: Human: 100%; Pig: 92%; Dog: 85%; Horse: 85%; Rabbit: 85%