GCNF (NR6A1) Rabbit Polyclonal Antibody

CAT#: TA330602

Rabbit Polyclonal Anti-NR6A1 Antibody

Product Images

WB Suggested Anti-NR6A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR6A1 antibody: synthetic peptide directed towards the N terminal of human NR6A1. Synthetic peptide located within the following region: FCQDELAELDPGTISVSDDRAEQRTCLICGDRATGLHYGIISCEGCKGFF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: nuclear receptor subfamily 6 group A member 1
• Database Link:
  NP_001480
  Entrez Gene 2649 Human
  UniProt ID Q15406
• Background: NR6A1 is an orphan nuclear receptor which is a member of the nuclear hormone receptor family. Its expression pattern suggests that it may be involved in neurogenesis and germ cell development. The protein can homodimerize and bind DNA, but in vivo targets have not been identified.This gene encodes an orphan nuclear receptor which is a member of the nuclear hormone receptor family. Its expression pattern suggests that it may be involved in neurogenesis and germ cell development. The protein can homodimerize and bind DNA, but in vivo targets have not been identified. The gene expresses at least alternatively spliced transcript variants.
• Synonyms: CT150; GCNF; GCNF1; hGCNF; hRTR; NR61; RTR
• Note: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors