LONRF3 Rabbit Polyclonal Antibody

CAT#: TA330468

Rabbit Polyclonal Anti-LONRF3 Antibody

Product Images

WB Suggested Anti-LONRF3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LONRF3 antibody: synthetic peptide directed towards the N terminal of human LONRF3. Synthetic peptide located within the following region: QPPPPLRVNVVLSGLLGKLFPGPARASQLRHEGNRLYRERQVEAALLKYN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: LON peptidase N-terminal domain and ring finger 3
• Database Link:
  NP_001027026
  Entrez Gene 79836 Human
  UniProt ID Q496Y0
• Background: LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear. The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.
• Synonyms: RNF127
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data

• Protein Families: Druggable Genome, Protease