ERF Rabbit Polyclonal Antibody

CAT#: TA330218

Rabbit Polyclonal Anti-ERF Antibody

Product Images

WB Suggested Anti-ERF Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERF antibody: synthetic peptide directed towards the middle region of human ERF. Synthetic peptide located within the following region: SSSPFKFKLQRPPLGRRQRAAGEKAVAAADKSGGSAGGLAEGAGALAPPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: ETS2 repressor factor
• Database Link:
  NP_006485
  Entrez Gene 2077 Human
  UniProt ID P50548
• Background: Members of the ETS family of transcription factors, such¡¡as ERF, regulate cell proliferation and differentiation. They share¡¡a highly conserved DNA-binding domain, the ETS domain, that¡¡recognizes the sequence GGAA/T.
• Synonyms: CRS4; PE-2; PE2
• Note: Immunogen sequence homology: Human: 92%

Reference Data

• Protein Families: Transcription Factors