SNAP45 (SNAPC2) Rabbit Polyclonal Antibody

CAT#: TA330157

Rabbit Polyclonal Anti-SNAPC2 Antibody

Product Images

WB Suggested Anti-SNAPC2 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

• 

  Immunohistochemistry with Human kidney lysate tissue

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNAPC2 antibody: synthetic peptide directed towards the middle region of human SNAPC2. Synthetic peptide located within the following region: STEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: small nuclear RNA activating complex polypeptide 2
• Database Link:
  NP_003074
  Entrez Gene 6618 Human
  UniProt ID Q13487
• Background: SNAPc is involved in transcription by two types of polymerases; it is required for transcription of both the RNA polymerase II and III small-nuclear RNA genes and binds specifically to the proximal sequence element PSE, a non-TATA-box basal promoter element common to these two types of genes. In addition, SNAPc is composed of at least three TAFs, SNAP43, SNAP45 and SNAP50.
• Synonyms: PTFDELTA; SNAP45
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors