CFAP299 Rabbit Polyclonal Antibody

CAT#: TA329793

Rabbit polyclonal Anti-C4orf22 Antibody

Product Images

WB Suggested Anti-C4orf22 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C4orf22 antibody: synthetic peptide directed towards the N terminal of human C4orf22. Synthetic peptide located within the following region: YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: chromosome 4 open reading frame 22
• Database Link:
  NP_689983
  Entrez Gene 255119 Human
  UniProt ID Q6V702
• Background: The specific function of C4orf22 is not yet known.
• Synonyms: MGC35043
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%